PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0011s1017.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 627aa    MW: 69028.6 Da    PI: 8.5846
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0011s1017.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B355.41.1e-1711102199
                          EEEE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                          ffkv+   d   ++ l+lp kf+ ++  ++   ++++  l+d+s r+W+v +  +k  g++ ++kGW++F ka++L+ gD+vvF++   +
  Kaladp0011s1017.2.p  11 FFKVM--IDEDFLRVLYLPPKFT-RIapDL--LKNTKTYLQDLSERKWNVAV--SKENGSFAIKKGWSDFGKAHNLEIGDIVVFHYFPGR 93 
                          89999..555555679******9.674644..46678***************..99999**************************87434 PP

                          EE..EEEEE-S CS
                   B3  89 efelvvkvfrk 99 
                           f  +v++f++
  Kaladp0011s1017.2.p  94 YF--TVQIFNR 102
                          55..8999887 PP

2B340.84e-135546203199
                          .--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                   B3  31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                             k ++l+d  +r+W v +    k+++ +lt+GW+ F +an+++ gD ++Fk+  ++e+++ v+++r+
  Kaladp0011s1017.2.p 554 SDAKLVILRDAASRVWPVHY--YHKPSMKILTTGWSAFSQANKVQLGDECIFKVAPEEETTYDVSIVRQ 620
                          456789**************..89999999***********************9877999999999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.96E-216105IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.9E-198105IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.9859103IPR003340B3 DNA binding domain
CDDcd100174.86E-2010101No hitNo description
SMARTSM010195.5E-1511103IPR003340B3 DNA binding domain
PfamPF023621.3E-1511102IPR003340B3 DNA binding domain
SMARTSM010190.001518621IPR003340B3 DNA binding domain
PROSITE profilePS5086311.646523621IPR003340B3 DNA binding domain
PfamPF023622.1E-10552620IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-12555619IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.67E-11556619IPR015300DNA-binding pseudobarrel domain
CDDcd100175.92E-9559619No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MGSLRETIVS FFKVMIDEDF LRVLYLPPKF TRIAPDLLKN TKTYLQDLSE RKWNVAVSKE  60
NGSFAIKKGW SDFGKAHNLE IGDIVVFHYF PGRYFTVQIF NRSACDVRNF GVDVGSTRKR  120
RRPEVIAADK NGKPAGNRDL DPLTAAPMES YKKGKREPAD FVVPMESNKR GKREPADFGD  180
ADIQFLMIDR NRVDEKREDR MVIDLSSYEM PNAEATSVIQ KAANGSPVPH AGVLVKHEAE  240
PGSTDAGNYD LPAADVVSVE QWAGNGPLIP HAGAVVQFKA EPGSMEVANL KQETKWDVVL  300
HESAKQMAID RSWHSDVKRE VHDTLAVGAP SRMTPMSPKY DAKSEVKKLS TAKPVVKIKK  360
EPGIQTSEET VIDLSDYKMS TADVKGSKER AGSRASALFA GSLVKCKAEP GSAEVSNIKQ  420
EMQCNAELPE RMKPVEIRRS SYAVVNRKVC EYDTTVAPGH TAPLVPKCDT NSDFLKLATP  480
KSGREAKTPY APGQSGNAFV KVKKEPQTET FEETGLAFVT AGAGDLHCPI TSASSLFLEL  540
PASLPLFRLT SQTSDAKLVI LRDAASRVWP VHYYHKPSMK ILTTGWSAFS QANKVQLGDE  600
CIFKVAPEEE TTYDVSIVRQ GSRPIS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117121RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53310.16e-09B3 family protein